Which of the following elements is the most reactive?
A. Mn
B. B
C. Sr
D. Kr

Answers

Answer 1

Answer:

The answer to this question is......C

Answer 2

Two or more than two atoms with different physical or chemical properties can not combine together to form an element. Therefore, Sr is the element which is most reactive. The correct option is option C.

What is element?

Element generally consist of atoms or we can atoms combine to form element. Atoms of an element is always same, means all the properties of all atoms of one type of element is same.

On going down the group of periodic table, size increases due to increase in number of shells, easiness to eject one electron increases. Group 2 elements are the most reactive as it has only 2 electrons to loose. Sr is the element which is most reactive among all the given options.

Therefore, Sr is the element which is most reactive. The correct option is option C.

To know more about element, here:

https://brainly.com/question/8460633

#SPJ2


Related Questions

Order the following events in a sequence that most logically describes the movement of water from the ocean to the bottom of a well in a village on the island.

1.infiltration
2.condensation
3.precipitation
4.evaporation

Answers

Answer:

3 ong

Explanation:

The answer is It is 3

IF YOU GIVE A LINK OR DON"T ACTUALLY ANSWER THIS QUESTION RIGHT JUST FOR POINTS I WILL REPORT YOUR ANSWER AND YOU

Describe what the Sim evidence shows you about attraction. Remember to use the words attraction, freedom of movement, kinetic energy, and overcome in your response.

Answers

Answer:

i forgot this but i already know kinetic energy. Absorbs attraction to energy that is in the atmosphere

The simulations clearly shows how the temperature affects the freedom of movement of particles of a substance and their force of attraction. As the temperature increases, the intermolecular attraction decreases, and the particles become more free to move apart.

What is intermolecular forces ?

Intermolecular forces of attraction are the forces that binds the molecules or particles of a substance together. There are various kinds of intermolecular forces.

The temperature is a significant factor affecting the intermolecular attraction. The kinetic energy of particles are directly proportional to the temperature.

As the temperature increases, kinetic energy of the particles to move apart increases resulting in the weakening of the force of attraction between them.

It is clear from the simulation that, at 36 degree Celsius, the particles are more closer , but when the temperature is increased to 206 degree Celsius, the particles have some space between as they started to move apart.

Find more on intermolecular attraction:

https://brainly.com/question/10626096

#SPJ3

What percentage of plant and animal species on Earth are found in tropical rainforests?

10%
20%
30%
more than 50%

Answers

50% because Terms in this set (26) What percentage of earth is covered by rainforests and what percentage of plants and animals live there ? Rainforests only cover around 2 percent the total surface area of the Earth, but really about 50 percent of the plants and animals on the earth live in the rainforest.

The correct answer is more than 50% .

Why more than 50%?

Rainforests are Earth’s oldest living ecosystem s, with some surviving in their present form for at least 70 million years. They are incredibly diverse and complex, home to more than half of the world’s plant and animal species even though they cover just 6% of Earth’s surface

learn more about tropical rainforests below,

https://brainly.in/question/819263

#SPJ2

Forms of Energy
Week of May 10th

Energy
Kinetic energy
Potential energy
Work
Mechanical energy
Sound energy
Thermal energy
Electric energy
Radiant energy
Nuclear energy

Answers

Explanation:

energy: power derived from the utilization of physical or chemical resources

kenetic energy: energy which a body possesses by virtue of being in motion

potential energy: the energy possessed by a body by virtue of its position relative to others

work: forced multiples distance

mechanical energy: energy of an object due to its motion or position; the sum of an objects kenetic energy and potential energy

sound energy: movement of energy through a substance

thermal energy: refers to energy contained within a system that is responsible for its temperature

electric energy: energy (both kinetic and potential) in the changed particles of an atom that can be used to apply force and/or do work

radiant energy: energy that travels by waves or particles

nuclear energy: energy in the nucleus, or core, of an atom

The gases in the can of compressed air are at the temperature of 298.3 K and a pressure of 270.3. If the gases in the can reach a pressure of 874.6 the can will explode. What temperature (in K) would the can need to be heated up for it to explode.

Answers

Answer:

The gases in the can of compressed air are at the temperature of 298.3 K and a pressure of 270.3.

Explanation:

Answer:

The gases in the can of compressed air are at the temperature of 298.3 K and a pressure of 270.3.

Explanation:

YOU'LL GET 60 POINTS + 5 STARS + HEART FROM ME IF YOU ANSWER THIS WITHOUT TROLLING
The table below shows the volume of two samples, X and Y, when placed in three containers of different volumes.
Volume of Samples
Volume of Container Volume of Sample X Volume of Sample Y
200 mL 200 mL 200 mL
500 mL 200 mL 500 mL
600 mL 200 mL 600 mL
Which of the following correctly describes the state of matter of one of the samples? (5 points)

a
Y is a gas because it has a definite volume.

b
X is a liquid because it has a definite volume.

c
Y is a liquid because it fills up the entire container.

d
X is a gas because it fills up the entire container.

Answers

X is a gas because it fills up the entire container
X because gas fills up an entire container, even if you can’t see it.

What types of environmental issues are facing the residents of Baltimore? Be specific. Examples of environmental issues include those related to water supply (including drought), wastewater, solid waste, energy, pollution (of soil, air, and water), congestion, and lack of natural spaces. Your answer should include at least 3 relevant environmental issues.

Answers

Answer:

Climate change is already impacting Baltimore residents, businesses and visitors. As atmospheric warming from greenhouse gases persists, Baltimore residents can expect to experience; Extreme temperatures. Excessive demand for cooling power, increasing demand on the electrical grid.Maryland's climate is changing. ... In the coming decades, changing the climate is likely to increase coastal and inland flooding; harm marine, wetland, and inland ecosystems; disrupt fishing and farming; and increase some risks to human health. Our climate is changing because the earth is warming.

Pluto was considered a planet from its discovery in 1930 until 2006. Why is it no longer called a planet?
A) Pluto does not directly orbit the Sun.
B) Pluto has not cleared its orbit of other objects.
C) Pluto does not orbit on the same plane with the other planets.
D) Pluto has not attained hydrostatic equilibrium.

It's not C, that's what I know

Answers

Answer:

B) Pluto has not cleared its orbit of other objects.

Explanation:

Pluto is a dwarf planet b/c it has not cleared its orbit of other objects.

Directly from library of congress: https://www.loc.gov/everyday-mysteries/astronomy/item/why-is-pluto-no-longer-a-planet/

Answer: D) Pluto has not attained hydrostatic equilibrium

Explanation:

Could someone help me? Will give a scobby snack!

Answers

1.)Venus is less massive that earth
2.)Nitrogen

Write a lab report on the lab ¨How do the process of conduction, convection, and radiation help distribute energy on earth.¨ for edge 1. Purpose- state the purpose of the lab.
2. Hypothesis- (Use if, then, because in your statement)
3. Materials- list all materials used in the lab
4. Procedures- state step by step what is being done in the lab
5. Observation/data- state what is being measured
6. Analysis/conclusion-state by summing up what was done in the lab and evaluate your
hypothesis with what actually happened

Answers

Answer: The sections of a lab report can vary between scientific fields and course requirements, but they usually contain the purpose, methods, and findings of a lab experiment. Each section of a lab report has its own purpose. 1. Title: expresses the topic of your study 2. Abstract: summarizes your research aims, methods, results, and conclusions

Explanation:

Which of these statements about cells is correct?

A) Adult cells are larger than those in a child.

B) Cells must produce their own food.

C) Organisms must have more than one cell to grow.

D) Multicellular organisms can have more than a billion cells.

Answers

Answer:

A) Adult cells are larger than those in a child.

Explanation:

Fully-grown adults are much larger in size than young children. 

A is correct to answer your question. The adult cells are larger than those in a child.

It's for my chem class. Please help! Even just answering one will help me out

Answers

1. d)Au

mark me brainliest

i am taco cat sponser

help me to rulezwrld

Answer:

full answer provided it below

Explanation:

The atom with the largest atomic radius is Au (Gold).

The atoms ranked in order of increasing atomic radius are F, Br, Ni, Fe, K, Ba.

The atoms ranked in order of increasing ionization energy are O, Sr, Sn, Ge, S, Ba.

The atoms ranked in order of increasing electronegativity are Ne, Fr, K, Ca, Co, P.

please help im really stressed and doing 2 tests at the same time

Answers

The answer is A, good luck
The answer is A because the minerals needed to make a phone is found underground only. Hope this helps if so mark me the brainiest!!

What observations did Galileo make with his telescope? Select all that apply.
star clusters in the Milky Way
comets in the Kuiper belt
craters on the Moon
moons of Jupiter

Answers

Answer:

Explanation:

Craters of the moon

4 moons on Jupiter

hope this helps

Answer:

Craters on the Moon

and moons of Jupiter

Potassium + Chlorine --> Potassium Chloride
Write the balanced chemical equation for this.
Will mark brainliest :)

Answers

Answer:

The balanced equation is 2K(s) + Cl2(g)→2KCl(s)

Answer:

The balanced Chemical is normaly

and Potassium+ Magnissium+ Potassium

Explanation:

I hope makatulong

and Pa follow po plss

Describe (with good adjectives) what an asteroid looks like. Write 2-3 sentences.



If you wanted to look for an asteroid, which two planets should you look between?



What do you call a space rock that enters the atmosphere of Earth, but doesn’t hit the earth?


What is the name of a space rock that crashes into Earth?

Answers

For the second one it would be Mars and Jupiter ;)

Which of the following should be measured with a meter stick, not a tape measure?
A.
the size of a student's waist
B.
the circumference of an orange
C.
the distance from the ground to the top of a ramp
D.
the length of ribbon needed to tie around a vase

Answers

The answer should be C since that is the only one where a tape measure is not necessary to measure rounded/smaller objects
C because for all the others a meter stick wont help due to limitation of height and it can’t bend since it’s a stick. Hope this helps if so mark me the brainiest

Use the picture of the heliocentric and geocentric models to answer the question below:


zoom_in
Which of the following statements best describes the models above?

Model 1 represents the old geocentric model of the solar system and Model 2 represents the newer heliocentric model of the solar system.

Model 1 represents the old heliocentric model of the solar system and Model 2 represents the new geocentric model of the solar system.

Model 1 represents the newer geocentric model of the solar system and Model 2 represents the old heliocentric model of the solar system.

Model 1 represents the old heliocentric model of the solar system and Model 2 represents the new geocentric model of the solar system.

Answers

Answer:

Model 1 represents the old geocentric model of the solar system and Model 2 represents the newer heliocentric model of the solar system.

Explanation:

Model 1 has earth in the center, therefore it is geocentric. the geocentric model of the solar system is old. Nobody believes in it anymore because it is scientifically inaccurate.

Model 2 has the sun in the center, therefore it is heliocentric. This is the newer model of the solar system.

How do we know what the temperature of the Earth was in the past?

What is the relationship between CO2 (carbon dioxide) and temperature on Earth?

What is the greenhouse effect?

Why are global sea levels rising?

Answers

Answer:

How do we know what the temperature of the Earth was in the past? - One way to measure past temperatures is to study ice cores. Whenever snow falls, small bubbles filled with atmospheric gases get trapped within it. In some places, so much snow falls that the older layers become buried and compressed into ice, locking away air bubbles in ice sheets and glaciers

What is the relationship between CO2 (carbon dioxide) and temperature on Earth? - When the carbon dioxide concentration goes up, temperature goes up. When the carbon dioxide concentration goes down, temperature goes down.

What is the greenhouse effect? - the trapping of the sun's warmth in a planet's lower atmosphere, due to the greater transparency of the atmosphere to visible radiation from the sun than to infrared radiation emitted from the planet's surface.

Why are global sea levels rising? - Global warming is causing global mean sea level to rise in two ways. First, glaciers and ice sheets worldwide are melting and adding water to the ocean. Second, the volume of the ocean is expanding as the water warms.

How do we know what the temperature of the Earth was in the past?One way to measure past temperatures is to study ice cores. When is the snowfalls is small bubbles filled with atmospheric gases get trapped within it.In some places so much snow falls that’s the old layers become buried and compressed into ice licking away a bubbles in ice sheets and glaciers.

What is the relationship between carbon dioxide and temperature on earth?When the carbon dioxide concentration goes up temperature goes up.When the carbon dioxide concentration goes down temperature goes down.

What is the greenhouse effect?.The trapping of the sons of warmth in appliance lower atmosphere due to the greater transparency of the atmosphere to visible radiation from the Sun then to infrared radiation emitted from the plants surface.

Scientists need to learn to make arguments based on evidence. That means they back up their statements with facts that support them. Prokaryotes and eukaryotes look very different. Please make an argument based on evidence that they should both be considered cells anyways.

Answers

All complex life on Earth is eukaryotic. All eukaryotic cells share a common ancestor that arose just once in four billion years of evolution. Prokaryotes show no tendency to evolve greater morphological complexity, despite their metabolic virtuosity. Here I argue that the eukaryotic cell originated in a unique prokaryotic endosymbiosis, a singular event that transformed the selection pressures acting on both host and endosymbiont.

The combination of massive bioenergetic expansion, release from genome-size constraints, and high mutation rate favored a protosexual cell cycle and the accumulation of eukaryotic traits. These factors explain the unique origin of eukaryotes, the absence of true evolutionary intermediates, and the evolution of sex in eukaryotes but not prokaryotes.

Kiana rides her skateboard with a constant speed of 6 km/h. How long will she take to travel a distance of 10 kilometers?

Answers

Answer:

100minutes

Explanation:

we take 6/km an hour and make it 1 km per 10 minutes and then multiply it by 100

Which reaction has the lowest activation energy?
explosion of fireworks
rotting of bananas
synthesis of water
combustion of oil

Answers

Answer:

rotting bananas

Explanation:

it takes time for bananas to rot while oil and fireworks combustion easier

I would say rotting bananas as well

Choose all the answers that apply.
Extinction can be caused by _____.
habitat destruction
natural disasters
disease
invasive species
The answer is all of the above

Answers

Answer:

All of above

Explanation:

There are still more like global warming, population over growth, and even overconsumption. But mainly habitat destruction, natural disasters, disease, and invasive species. Just remember that this are all naturally occurring ways of extinction.  

Imagine that you have just made a fresh apple pie. When you take it out of the oven, it is so hot, you can't even hold it in your hand; so you place it on the kitchen table. Now, several minutes later, you are able to cut a slice and eat it. The apple pie has cooled, the question now is, where has the heat gone? Select which of the following below is most likely to have occurred and provide a well developed, written explanation for your response using scientific principles learned in class.

Answers

Answer:

Radiation (I think)

Explanation:

The electromagnetic radiation emitted from the source carries heat energy away from the source to surroundings, the infrared or electromagnetic waves escape from the hot apple pie through radiation into the surrounding air.

The table below shows the volume of two samples, X and Y, when placed in three containers of different volumes.

Volume of Samples
Volume of Container Volume of Sample X Volume of Sample Y
200 mL 200 mL 200 mL
500 mL 200 mL 500 mL
600 mL 200 mL 600 mL
Which of the following correctly describes the state of matter of one of the samples? (5 points)

a
Y is a gas because it has a definite volume.

b
X is a liquid because it has a definite volume.

c
Y is a liquid because it fills up the entire container.

d
X is a gas because it fills up the entire container.

Answers

Answer:

a

Explanation:

trust me picked it

Ms. Hu was teaching her students about Earth days and Earth years. She set up this model. How should Ms. Hu move the parts of her model to illustrate an Earth day? Describe what an Earth day is in terms of the movement of the Earth/Sun.

(Earth Science)

Answers

Explanation:

Earth spins around its axis, just as a top spins around its spindle. This spinning movement is called Earth's rotation. At the same time that the Earth spins on its axis, it also orbits, or revolves around the Sun. This movement is called revolution.

The Earth spins on its axis

pleaseee help
science
ILL GIVE BRAINLEY IF CORRECT

Answers

Answer:

true

Explanation:

The answer is true codicia

What two factors determine a planet’s orbit? Select all that apply.
planet’s shape
planet’s velocity
gravity
planet’s volume

Answers

Answer: The two main factors that determine a planet's orbit are the mass of the planet and the mass of the object it is orbiting (such as a star)

Explanation: The gravitational force between these two objects causes the planet to follow an elliptical orbit around the object. The planet's velocity, or speed, also plays a role in its orbit, as it determines the shape of the orbit. The shape of the planet itself does not significantly affect its orbit. The planet's volume may have some effect on its orbit if the planet has a high density and therefore a strong gravitational pull, but it is not a primary factor.

Using the graph above, which species has the highest management costs?

brown tree snakes
fire ants
mosquitoes
termites

Answers

The one with the most management cost is Brown tree snakes

Highest is brown tree snakes of u look at the colour coding then look at the graph you can see it is the most

Hello, Help please...?

Inspecting and monitoring cargo ships and planes for invasive species is cheaper than waiting for the species to establish and spread widely in its non-native environment before responding.
false
true

Answers

It is true for inspecting the cargo
Other Questions
what is a difference between mass and volume 87.5 - 23.4 *O 64.1O 110.9054.1 What is the theoretical probability that an even number will be rolled on a number cube? I dont understand and also any fake answers will be reported The US policy against the spread of communism was called The Truman Doctrine. True or False How could the matter in a piece of rock at the top of a mountain eventually be incorporated into volcanic lava? Write a short essay showing how the atmosphere, hydrosphere, cryosphere, geosphere, and biosphere are involved in this process. Put the continuum of force in order from least to greatest force: A. Verbal Officer + Presence + Lethal + Empty Hand + Less LethalB. Less Lethal + Empty Hand + Lethal + Verbal + Officer PresenceC. Officer Presence + Verbal + Empty Hand + Less Lethal + Lethal what is 9.5 is what % of 50 i have a test tomorrow 1/11/23 and I dont understand it PPPLSSSSSS HELPPPPPP ILL GIVE BRAINLYEST Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom The lesson of the story is Never giveup!" What else might the author add tothe lesson of the story? Find the lope-intercept equation of the line that pae through (1,-3) and ha a lope of -1/4 What is the main idea of Geographical Landforms ? Can someone please help I need the answers please!!!!!!!!!!!! What are the 4 main purposes of text? The majority of thread Meister customers live outside of cities in colder climates Write a procedure ConvertToBinary that takes an input as a number from 0 to 16 (including 0 but not 16) and converts it to a binary number. The binary number should be returned as a list. A ________________ helps you "see" the previous frame and helps keep the movement of the video consistent. overlay appframes per secondhaunted framesonion skinghost skin Dan drank 7/8 of a bottle of water During basketball practice. He then drank Another 4/8 of a bottle after practice. How much water did he drink altogether thats The Night is a big black catThe Moon is her topaz eye,The stars are the mice she hunts at night,In the field of the sultry skyIdentify a metaphor from the poem In a storeroom,there are 30 blue balls,48 green balls,some red balls and some white balls. there are 3 times as many green balls as red balls and 5 times as many blue balls as white balls.(a) How many balls are there altogether?(b) How many balls are left in the room if 7/10 (fraction) of the balls are taken away?pls help me answer both